Interleukin-10, 19-178aa, Human, His-Tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Interleukin-10 (IL-10) is also known as human cytokine synthesis inhibitory factor (CSIF) and inhibits the synthesis of pro-inflammatory cytokines like IFN-gamma, IL2, IL3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. This protein has effects in immunoregulation and inflammation and downregulates the expression of Th1 cytokines, MHC class II antigens, and costimulatory molecules on macrophages.
List Price: $1077
  • Buy 5 for $1023.15 each and save 5%
  • Buy 21 for $969.3 each and save 10%
  • Buy 31 for $915.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02677
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.94 kDa (181 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 20% glycerol
Other Names IL-10, CSIF, TGIF, IL10A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap