IL9, 1-144aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
Interleukin 9, also known as IL-9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. This protein produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells and stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. Recombinant human IL9, fused to His-tag at C-terminus, was expressed in Sf9 and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02650
Size 50 µg
Host Insect cell
Accession
Molecular Weight 14.9kDa (132aa) Multiple bands between 18-28kDa, reducing conditions.
AP_Mol_Weight
Tag N-6His
Sequences QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKIHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by BCA assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 10% glycerol.
Other Names Interleukin-9, HP40, IL-9; P40
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap