IL6, 21-207aa, Canine, His-tag, Baculovirus

Categories: [Proteins / Peptides]
IL6, as known as Interleukin-6, is a phosphorylated and variably glycosylated cytokine. It is secreted by T cells and macrophages to stimulate immune response during infection and after trauma, especially burns or other tissue damage leading to inflammation. Also, this protein can function as an anti-inflammatory molecule, as in skeletal muscle where it is secreted in response to exercise. Recombinant canine IL6, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02646
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 22.0kDa (195aa)18-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences FPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIMLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Interleukin-6, IL6, IL-6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap