IL3, 20-152aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
IL3, as known as interleukin 3, is a pleiotropic factor produced primarily by activated T cells that can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. Also, this protein affects the functional activity of mature mast cells, basophils, eosinophils and macrophages. Because of its multiple functions and targets, it was originally studied under different names, including mast cell growth factor, P-cell stimulation factor, burst promoting activity, multi-colony stimulating factor, thy-1 inducing factors and WEHI-3 growth factor. Recombinant human IL3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $118
  • Buy 5 for $112.1 each and save 5%
  • Buy 21 for $106.2 each and save 10%
  • Buy 31 for $100.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02634
Size 5 µg
Host Baculovirus
Accession
Molecular Weight 16.1kDa (141aa); 13.5-18kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Interleukin 3, IL3, IL-3, MULTI-CSF, MCGF
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap