IL2RG, 23-262aa , Human, His tag, Insect cell

Categories: [Proteins / Peptides]
IL2RG, also known as Interleukin-2 receptor common subunit gamma, is a cytokine receptor sub-unit that is common to the receptor complexes for at least six different interleukin receptors. This protein is located on the surface of immature blood-forming cells in bone marrow. One end of the protein resides outside of the cell where it binds to cytokines and the other end of the protein resides in the interior of the cell where it transmits signals to the cell's nucleus. The common gamma chain partners with other proteins to direct blood-forming cells to form lymphocytes. It also directs the growth and maturation of lymphocyte subtypes. These cells kill viruses, make antibodies, and help regulate the entire immune system. Recombinant human IL2RG, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02633
Size 50 µg
Host Insect cell
Accession
Molecular Weight 29.0KDa (246aa) 40-57kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4)
Other Names Cytokine receptor common subunit gamma , CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap