Home / Products / proteins / IL1rn, 27-178aa, Rat, His tag, E.coli

IL1rn, 27-178aa, Rat, His tag, E.coli

Categories: [Proteins / Peptides]
IL1rn also known as Interleukin-1 receptor antagonist protein is a member of the interleukin 1 cytokine family. IL1rn may represent a reservoir of IL-1 inhibitors, released upon cell death, whose function is no limit the pro-inflammatory signals but most prominently by mononuclear phagocytes and keratinocytes. IL1rn is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Recombinant rat IL1rn, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02628
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.8kDa (175aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffer Saline (pH7.4) containing 10% glycerol, 1mM DTT
Other Names Interleukin-1 receptor antagonist protein, IL-1ra, il1ra
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap