Home / Products / proteins / IL1RN, 27-178aa, Mouse, His tag, E.coli

IL1RN, 27-178aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Interleukin 1 receptor antagonist (IL1RN), also known as IL1-RA, is a member of the interleukin 1 cytokine family. IL1RN may represent a reservoir of IL-1 inhibitors, released upon cell death, whose function is no limit the pro-inflammatory signals but most prominently by mononuclear phagocytes and keratinocytes. IL1RN is reported to be associated with increased risk of osteoporotic fractures and gastric cancer.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02627
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.0 kDa (177aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol
Other Names Interleukin 1 receptor antagonist, F630041P17Rik, IL-1ra.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap