Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP02626 |
Size | 50 µg |
Host | Baculovirus |
Accession | |
Molecular Weight | 36kDa (318aa), 40-57kDa (SDS-PAGE under reducing conditions.) |
AP_Mol_Weight | |
Tag | |
Sequences | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSLEHHHHHH |
Purity | > 95% by HPLC |
Concentration | 0.5mg/ml (determined by Absorbance at 280nm) |
Formulation | Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol |
Other Names | Interleukin-1 receptor-like 1 isoform 1 , IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1, DER-4, DER4, FIT 1, Growth stimulation expressedhomolog of mouse growth stimulation-expressedIl1rl1. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap