IL17B, 21-180aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
IL17B, also known as interleukin-17B isoform 1, is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. It plays a role in inflammation and bone growth. IL-17B binds to IL-17 RB and induces the production of inflammatory cytokines and the infiltration of inflammatory immune cells. Recombinant human IL17B protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $240
  • Buy 5 for $228 each and save 5%
  • Buy 21 for $216 each and save 10%
  • Buy 31 for $204 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02615
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 19.2kDa (169aa)18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIFHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Interleukin-17B isoform 1, IL17B, IL-17B, IL-20, NIRF, ZCYTO7
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap