IL17A, 24-155aa , Human, His tag, Insect cell

Categories: [Proteins / Peptides]
IL17A, also known as Interleukin 17, is a cytokine that acts as a potent mediator in delayed-type reactions by increasing chemokine production in various tissues to recruit monocytes and neutrophils to the site of inflammation. It is produced by T-helper cells and is induced by IL23 which results in destructive tissue damage in delayed-type reactions. This protein is a 155 amino acid protein that is a disulfide-linked, homodimeric, secreted glycoprotein with a molecular mass of 35kDa. The structure of IL17A consists of a signal peptide of 23 amino acids followed by a 123 aa chain region characteristic of the IL17 family. An N-linked glycosylation site on the protein was first identified after purification of the protein revealed two bands, one at 15kDa and another at 20kDa. Recombinant human IL17A, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02613
Size 50 µg
Host Insect cell
Accession
Molecular Weight 15.9kDa (138aa) 13.5-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 20% glycerol, 1mM EDTA, 0.1mM PMSF.
Other Names Interleukin 17A, CTLA8, IL-17, IL-17A, IL17
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap