IL12RB1, 24-545aa , Human, His tag, Insect cell

Categories: [Proteins / Peptides]
IL12RB1, also known as Interleukin-12 receptor subunit beta-1, is a intercellular adhesion molecule 1. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. It forms a disulfide-linked oligomer, which is required for its IL12 binding activity. The coexpression of this protein and IL12RB2 was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. Recombinant human IL12RB1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02608
Size 50 µg
Host Insect cell
Accession
Molecular Weight 58.4kDa (528aa) 50-70kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 20% glycerol, 1mM EDTA, 0.1mM PMSF.
Other Names Interleukin-12 receptor subunit beta-1 isoform 1 , CD212, IL-12R-BETA1, IL12RB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap