IL12P40, 23-328aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
IL12P40 (interleukin 12 subunit beta), also known as natural killer cell stimulatory factor 2, or cytotoxic lymphocyte maturation factor 2, p40, belongs to the type I cytokine receptor family. This protein is a cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02606
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 35.8kDa (315aa)
AP_Mol_Weight
Tag N-6His
Sequences ADPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 100mM NaCl, 0.1mM PMSF
Other Names Interleukin 12 subuit beta, CLMF, NKSF, CLMF2, NKSF2, IL-12B.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap