Home / Products / proteins / IL11ra1, 24-371aa, Rat, His tag, Baculovirus

IL11ra1, 24-371aa, Rat, His tag, Baculovirus

Categories: [Proteins / Peptides]
Il11ra1, also known as interleukin-11 receptor subunit alpha, is a subunit of the interleukin 11 receptor which is a member of the hematopoietic cytokine receptor family. It can utilize IL6ST for initiating signal transmission. It is expressed in a number of cell lines, including the myelogenous leukemia cell line K562, the megakaryocytic leukemia cell line Mo7E, the erythroleukemia cell line TF1, and the osteosarcoma cell lines, MG-63 and Saos-2. It is also expressed in normal and malignant prostate epithelial cell lines. Recombinant rat Il11ra1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $220
  • Buy 5 for $209 each and save 5%
  • Buy 21 for $198 each and save 10%
  • Buy 31 for $187 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02604
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 39.2kDa (356aa), 40-57kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences TPCPQAWGPPGVQYGQPGRPVMLCCPGVNAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPEVSCQAVDYENFSCTWSPGRVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQRILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEELITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGPLRDEVPDGSRGHEQKLEAAAQEDSPAPPSPSLQPDPRPLDHRDPLEQVAVLAVEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Interleukin-11 receptor subunit alpha, Il11ra1, CRSDA, hCG_2011440, I11RA_HUMAN, IL-11 receptor subunit alpha, IL-11R subunit alpha, IL-11R-alpha, IL-11RA, IL11RA, Interleukin 11 receptor alpha.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap