IL-32, 1-131aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Interleukin-32 (IL-32) isoform A belongs to cytokine family. This protein expression is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. It has the ability to induce proinflammatory cytokines such as TNFα and IL8 in THP1 cells, and activates typical cytokine signaling pathways involving NFκB and p38. IL-32 can also support osteoclast differentiation but not osteoclast activation by regulating the MAPK/ERK pathway and the actin cytoskeleton.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02598
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.1 kDa (168aa)
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1mM DTT,10% glycerol
Other Names Interleukin 32 isoform A, IL-32, Natural killer cells protein 4(NK4), Tumor necrosis factor alpha-inducing factor (TAIF)
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap