IL-1 receptor antagonist, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
One of the most potent pro-inflammatory mediators is the early-acting cytokine interleukin-1 (IL-1), whose actions are regulated by the structurally related IL-1 receptor antagonist (IL-1 RA). IL-1 RA is a competitive IL-1 inhibitor and a powerful anti-inflammatory agent.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02589
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.2kDa (153aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate-buffered Saline(pH 7.4)
Other Names IL-1ra, IL-1RN, IRAP, IL1 inhibitor, ICIL-1RA, Anakinra IL1F3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap