IL-1β, 117-269aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Interleukin-1 (IL-1) has been considered a potentially important inflammatory mediator. It is composed of two distinct proteins, called as IL-1α and IL-1β. IL-1 is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β bind to the same receptor and they are structurally related polypeptides that share approximately 20% amino acid.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02595
Size 100 µg
Host E.coli
Accession
Molecular Weight 17kDa (154aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate-buffered Saline(pH 7.4)
Other Names Interleukin 1β, IL-1, IL1F2, IL1-beta, Catabolin
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap