Home / Products / proteins / IGFLR1, 23-163aa, Human, His tag, E.coli

IGFLR1, 23-163aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
IGF-like family receptor 1, also known as IGFLR1, is a 167 amino acid protein encoded by a gene mapping to human chromosome 19. This protein probably is cell membrane receptor for the IGF-like family proteins. IGFLR1 binds IGFL1 and IGFL3 with a higher affinity and may also bind IGFL2. Recombinant human IGFLR1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02586
Size 50 µg
Host E.coli
Accession
Molecular Weight 17.5kDa (164aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSSQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 0.2M NaCl, 50% glycerol, 2mM DTT
Other Names IGF-like family receptor 1, TMEM149, U2AF1L4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap