Igfbp6, 26-238aa, Mouse,, His-tag, Baculovirus

Categories: [Proteins / Peptides]
Igfbp6, also known as insulin-like growth factor-binding protein 6, binds insulin-like growth factor 1(IGF-1) and IGF-2 with high affinity and inhibits IGF action in vitro. It is a cysteine-rich protein with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. It plays a key role in the regulation of IGF bioavailability, by modulating its molecular size, capillary membrane permeability, target tissue specificity, cell membrane adherence and IGF affinity. Recombinant mouse Igfbp6, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02583
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 23.7kDa (221aa), 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences ALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQPCGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPSEETTKESKPQGGASRSRDTNHRDRQKNPRTSAAPIRPNPVQDSEMGPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPCWCVDPMGQPLPVSPDGQGSTQCSARSSGLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 40% glycerol
Other Names Insulin-like growth factor-binding protein 6 , Igfbp6, IGFBP-6, IBP 6, IBP-6, IBP6, IBP6_HUMANIGF binding protein 6, IGF-binding protein 6IGFBP 6, IGFBP-6, IGFBP6, Insulin like growth factor binding protein 6, Insulin-like growth factor-binding protein 6.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap