IGF2, 25-91aa, Human, E.coli

Categories: [Proteins / Peptides]
IGF2, as known as insulin-like growth factor 2, is mitogenic polypeptide growth factors that stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. This protein is a fetal growth factor, influenced by placental lactogen and abundantly expressed by placental trophoblasts.
List Price: $220
  • Buy 5 for $209 each and save 5%
  • Buy 21 for $198 each and save 10%
  • Buy 31 for $187 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02581
Size 50 μg
Host E.coli
Accession
Molecular Weight 7.6 kDa (68aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate-buffered saline ( pH 7.4) containing 10% glycerol
Other Names Insulin-like growth factor 2, Somatomedin-A, INSIGF
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap