IGF-1, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
The Insulin-like growth factor-1(IGF-1) is mitogenic polypeptide growth factors that stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF-1 is predominantly produced by the liver, although a variety of tissues produce the IGFs at distinctive times. The IGF-1 belongs to the insulin gene family, which also contains insulin and relaxin.
List Price: $105
  • Buy 5 for $99.75 each and save 5%
  • Buy 21 for $94.5 each and save 10%
  • Buy 31 for $89.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02580
Size 100 µg
Host E.coli
Accession
Molecular Weight 7.7kDa (71aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate-buffered Saline(pH 7.4) containing 10% glycerol
Other Names Insulin-like growth factor-1, IGF-IA, Somatomedin-C, MGF, IBP1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap