IFNL3, 22-196aa , Human, His tag, Insect cell

Categories: [Proteins / Peptides]
IFNL3, also known as Interferon lambda-3, is a secreted protein which belongs to the IL-28/IL-29 family. It is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. This protein displays potent antiviral activity and antitumor activity. It seems to signal through the Jak-STAT pathway. It also contributes to viral resistance and is known to be upregulated by interferons and by RNA virus infection. Recombinant human IFNL3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02578
Size 50 µg
Host Insect cell
Accession
Molecular Weight 20.4kDa (181aa) 18-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate buffered saline (pH 7.4) containing 20% glycerol, 1mM EDTA, 0.1mM PMSF.
Other Names Interferon lambda-3 , IL-28B, IL28B, IL28C
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap