Home / Products / proteins / IFNL1, 20-200aa, Human, His tag, Baculovirus

IFNL1, 20-200aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
IFNL1, as known as interferon lambda-1, is a secreted protein which belongs to the IL28/29 family. It is a cytokine with immunomodulatory activity. This protein is highly similar in amino acid sequence to the IL28. Also, it plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. It may play a role in antiviral immunity. Recombinant human IFNL1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02575
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 20.8kDa (187aa), 18-28kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Interferon lambda-1, IFNL1, IL-29, IL29, Cytokine ZCYTO21, IFN lambda 1, IFN-lambda-1, IL29_HUMAN, Interferon lambda 1, Interferon lambda-1, Interleukin 29 (interferon, lambda 1), Interleukin-29.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap