Home / Products / proteins / IFNG,24-167aa, Feline, His-tag, E.coli

IFNG,24-167aa, Feline, His-tag, E.coli

Categories: [Proteins / Peptides]
Interferon gamma, also known as IFNG, is a member of the type ? interferon family. This protein is a soluble cytokine with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. Mutations in this gene are associated with aplastic anemia. Recombinant Feline IFNG protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02574
Size 50 µg
Host E.coli
Accession
Molecular Weight 19.3kDa (167aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGSQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm )
Formulation Liquid. In PBS buffer (pH 7.4) containing 10% glycerol
Other Names Interferon gamma, IFN-G, IFN-gamma
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap