Home / Products / proteins / IFNG, 24-161aa, Human, His tag, E.coli

IFNG, 24-161aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
IFNG, also known as interferon gamma, is secreted by lymphocytes stimulated by mitogen and is involved in the differentiation, maturation, and proliferation of hematopoietic cells. Nature human interferon-γ is composed of 143 amino acid residues without cysteine residues and is glycosylated. Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02572
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.5 kDa (159aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. Phosphate buffered saline (pH 7.4)
Other Names Interferon gamma, IFG, IFI.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap