Ifng, 23-155aa, Mouse, His tagged, E.coli

Categories: [Proteins / Peptides]
Ifng, also known as interferon gamma, is secreted by lymphocytes stimulated by mitogen and is involved in the differentiation, maturation, and proliferation of hematopoietic cells. This protein is a soluble cytokine with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. Mutations in this gene are associated with aplastic anemia. Recombinant mouse Ifng protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02570
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.2 kDa (158aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM Tris-HCl(pH7.5) containing 1mM DTT, 20% glycerol
Other Names Interferon gamma, Ifg, IFN-g
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap