IdhA, 1-329aa, E.coli, His tag, E.coli,

Categories: [Proteins / Peptides]
Idha, also known as D-lactate dehydrogenase, belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. In enzymology, a D-lactate dehydrogenase (cytochrome) is an enzyme that catalyzes the chemical reaction. Thus, the two substrates of this enzyme are (D)-lactate and ferricytochrome c, whereas its two products are pyruvate and ferrocytochrome c. Recombinant E.coli IdhA protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02556
Size 100 µg
Host E.coli
Accession
Molecular Weight 39.1kDa (353aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMKLAVYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGCEAVCIFVNDDGSRPVLEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEAVAEHAIGMMMTLNRRIHRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAAALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFEQMKNGVMIVNTSRGALIDSQAAIEALKNQKIGSLGMDVYENERDLFFEDKSNDVIQDDVFRRLSACHNVLFTGHQAFLTAEALTSISQTTLQNLSNLEKGETCPNELV
Purity > 95% by HPLC
Concentration 1mg/ml
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 10% glycerol, 100mM NaCl
Other Names fermentative D-lactate dehydrogenase, NAD-dependent, ECK1377, hslF, hslI, htpH, JW1375.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap