HSPC159, 1-172aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
HSPC159, also designated galectin-related protein (GRP), is a 172 amino acid protein that contains one galectin domain. This protein does not appear to bind carbohydrates or lactose because the critical residues required for binding are not conserved. Recombinant human HSPC159 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02541
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.6 kDa (196aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl.
Other Names Galectin-related protein, GRP, MGC33751, MGC71953.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap