Home / Products / proteins / HSPB9, 1-159aa, Human, His tag, E.coli

HSPB9, 1-159aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
HSPB9, also known as CT51, belongs to the small heat shock protein (HSP20) family. Localizing to the cytoplasm as well as the nucleus, HSPB9 is expressed specifically in the testis. Recombinant human HSPB9 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02538
Size 50 µg
Host E.coli
Accession
Molecular Weight 19.6 kDa (179aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 50% glycerol, 0.2M NaCl, 2mM DTT
Other Names Heat shock protein beta-9, CT51 (cancer/testis antigen 51).
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap