HSPB8/HSP22, 1-196aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Heat shock protein beta-8 (HSPB8), also known as HSP22, member of the small heat shock protein superfamily. HSPB8 is predominantly transcribed in skeletal muscle and heart. The chaperone-like activity is of great importance to the function of HSPB8 in various processes including proliferation, apoptosis and macroautophagy. Mutations in the HSPB8 gene are associated with the inherited peripheral neuropathies, autosomal dominant distal hereditary motor neuropathy type IIA (dSMA) and axonal Charcot-Marie-Tooth disease type 2L (CMT2L).
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02537
Size 50 µg
Host E.coli
Accession
Molecular Weight 23.7 kDa (216aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 100mM NaCl,10% glycerol
Other Names Heat shock protein beta-8, CRYAC, E2IG1, CMT2L, DHMN2, HMN2, HMN2A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap