Home / Products / proteins / HSPB2, 1-182aa, Human, His tag, E.coli

HSPB2, 1-182aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
HSPB2, also known as heat shock protein beta-2, belongs to the small heat shock protein (HSP20) family. This protein may regulate the kinase DMPK. Recombinant human HSPB2 protein, fused to His-tag at Nterminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02533
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.8 kDa (206aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
Purity > 95% by HPLC
Concentration > 90% by SDS - PAGE
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 1mM DTT
Other Names Heat shock protein beta-2, Hs.78846, HSP27, LOH11CR1K, MKBP.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap