Home / Products / proteins / HSD17B10, 12-261aa, Human, His tag, E.coli

HSD17B10, 12-261aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
HSD17B10 is a member of the short-chain dehydrogenase/reductase superfamily. This mitochondrial protein catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. HSD17B10 plays an important role in processing steroid hormones and fats, and also helps break down the protein building block (amino acid) isoleucine. This enzyme is also necessary for several chemical reactions involving female sex hormones (estrogens) and male sex hormones (androgens).
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02510
Size 100 µg
Host E.coli
Accession
Molecular Weight 28.1 kDa (271aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT, and 100 mM NaCl.
Other Names 3-hydroxyacyl-CoA dehydrogenase type-2, 17b-HSD10, ABAD, CAMR, DUPXp11.22, ERAB, HADH2, HCD2, MHBD, MRPP2, MRX17.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap