Home / Products / proteins / HSBP1L1, 1-74aa, Human, His tag, E.coli

HSBP1L1, 1-74aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Heat shock factor binding protein 1-like, also known as HSBP1L1, belongs to a family of eukaryotic proteins identified as nucleotide exchange factors for HSP 70, which exhibit varying degrees of compartment and species specificity. This gene expression is regulated primarily at the transcription level. Recombinant human HSBP1L1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02506
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.8 kDa (97aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMDVRGPEAPGGRALRDAAENLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVNDLMVQAGIENSIKEQMLKT
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline(pH 7.4) containing 10% glycerol
Other Names Heat shock factor binding protein 1-like, FLJ10967, Heat shock factor-binding protein 1-like protein 1, MGC189743
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap