Home / Products / proteins / HSBP1 (Heat shock factor binding protein 1), Human, Recombinant, E.coli

HSBP1 (Heat shock factor binding protein 1), Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Heat shock factor binding protein 1 (HSBP1) is a 76 amino acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulated HSF1 DNA-binding activity. This protein was overexpressed in E.coli and was purified to apparent homogeneity by using conventional column chromatography techniques.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02505
Size 100 µg
Host E.coli
Accession
Molecular Weight 8.5kDa (76aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing, 50 mM NaCl, 20% glycerol
Other Names Heat shock factor binding protein 1, NPC-A-13, HSF1BP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap