HRAS-like suppressor3,1-133aa, Human,Recombinant, E.coli

Categories: [Proteins / Peptides]
The HRAS like-suppressor 3 (HRASLS3) belongs to a class II tumor suppressor gene family and is involved in the regulation of differentiation and survival. This protein is expressed in several human tumors including ovarian carcinomas, lung carcinomas and may be involved in interferon-dependent cell death. Recombinant HRAS-like suppressor 3 was expressed in E.coli and was purified by conventional chromatography techniques.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02501
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.9 kDa (133 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0)
Other Names HRASLS3, PLA2G16, AdPLA, H-REV107-1, HREV107, HREV107-3, MGC118754
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap