Home / Products / proteins / HRAS, 1-186aa, Human, His-tag, E.coli

HRAS, 1-186aa, Human, His-tag, E.coli

Categories: [Proteins / Peptides]
HRAS, also known as GTPase HRas, belongs to the Ras family which function in signal transduction pathways. This protein can bind GTP and GDP, and it has intrinsic GTPase activity. HRAS undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02500
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.0 kDa (194aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl
Other Names v-Ha-ras Harvey rat sarcoma viral oncogene homolog, C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO, H-RASIDX, HAMSV, HRAS1, K-RAS, N-RAS, RASH1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap