Hpgd, 1-269aa, Mouse, His tagged, E.coli

Categories: [Proteins / Peptides]
Hpgd, also known as Hydroxyprostaglandin dehydrogenase, is a member of the short-chain dehydrogenases/reductases family. It metabolizes prostaglandins (PGs) to render them. Prostaglandins (PGs) play a crucial role in mediating parturition events, and their synthesis and metabolism are regulated by PGH synthase and 15-hydroxy-PG dehydrogenase (PGDH), respectively. Hpgd, a COX-2 oncogene antagonist, is a TGF-beta-induced suppressor of human gastrointestinal cancers. Recombinant mouse Hpgd protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02493
Size 100 µg
Host E.coli
Accession
Molecular Weight 31.6kDa (292aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQDYDISPLLVKAPLTS
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM Tris-HCl (pH 8.0) containing 30% glycerol
Other Names 15-Hydroxyprostaglandin dehydrogenase [NAD (+)], 15-PGDH, AV026552
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap