HMGN3, 1-77aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
HMGN3, also known as high mobility group nucleosomal binding domain 3, binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. It is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Recombinant human HMGN3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02473
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.8 kDa(100aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by BCA assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH7.0) containing 10% glycerol
Other Names High mobility group nucleosomal binding domain 3, PNAS-24, PNAS-25, TRIP7
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap