Home / Products / proteins / HMGB1, 1-215 aa, Human, His tagged, Recombinant, Baculovirus

HMGB1, 1-215 aa, Human, His tagged, Recombinant, Baculovirus

Categories: [Proteins / Peptides]
High mobility group box1 protein (HMGB1) is a very abundant chromatin-binding protein residing in the eukaryotic cell nucleus and acting in the assembly of nucleoprotein complexes. Inside the cell, HMGB1 binds to DNA and has a role in transcriptional regulation. Outside the cell, HMGB1 acts as a cytokine and has activities that resemble those of tumor necrosis factor.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02468
Size 100 µg
Host Baculovirus
Accession
Molecular Weight 25kDa (223aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 0.5 mM DTT,1 mM EDTA, 10% glycerol
Other Names High-mobility group box1, HMG1, HMG3, SBP-1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap