Home / Products / proteins / HMGA1, 1-107aa, Human, His tag, E.coli

HMGA1, 1-107aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
High mobility group protein HMG-I/HMG-Y, also known as HMGA1, is a member of the non-histone chromosomal high mobility group protein (HMG) family. HMGA1 consists of a highly conserved AT-hook DNAbinding domain that mediates binding to AT-rich sequences in the minor groove of chromosomal DNA. It functions as architectural chromatin-binding transcription factor altering the conformation of DNA by modulating nuclear protein-DNA complexes.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02466
Size 50 µg
Host E.coli
Accession
Molecular Weight 12.7 kDa (115aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 50% glycerol, 0.2M NaCl
Other Names High mobility group protein HMG-I/HMG-Y, HMG-R, HMGA1A, HMGIY
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap