Home / Products / proteins / HINT1, 1-126 aa, Human, Recombinant, E.coli

HINT1, 1-126 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
HINT1, also known as Histidine triad nucleotide-binding protein 1, is a member of superfamily named for a near C-terminal HXHXHXX motif (H:Histidine, X:a hydrophobic amino acid) positioned at the α-phosphate of nucleotide substrates. This protein hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMPmorpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02452
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.8 kDa (126aa)
AP_Mol_Weight
Tag
Sequences MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Histidine triad nucleotide-binding protein 1, HINT, PKCI-1, PRKCNH1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap