HIF1a, 1-85aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Hypoxia-inducible factor-1 (HIF-1), identified as one of the transcription factors, has been found to play an essential role in oxygen homeostasis. HIF-1 is a heterodimer composed of HIF-1 beta subunit and one of three subunits (Hif-1 alpha, Hif-2 alpha or Hif-3 alpha). The activation of Hif-1 alpha is closely associated with a variety of tumors and oncogenic pathways. Hif-1 alpha consists of DNA binding domain(DBD domain), dimerization domain and C-terminal regulatory domains, including two transactivation domains(TAD), an oxygen-dependent degradation(ODD) domain, and inhibitory domains.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02450
Size 10 µg
Host E.coli
Accession
Molecular Weight 11.8 kDa (105aa), confirmed by MALDI-TOF, (molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMK
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris buffer(pH 8.0) containing 20% glycerol, 1mM DTT, 0.2M NaCl, 1mM EDTA.
Other Names Hypoxia-inducible factor 1-alpha, BHLHE78, MOP1, PASD8.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap