HERPUD1, 1-263a Human, His tag, E.coli

Categories: [Proteins / Peptides]
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, also known as HERPUD1, is a 391 amino acid multi-pass membrane protein that localizes to the ER and contains one N-terminal ubiquitin-like domain. Widely expressed with highest expression in the brain, HERP is a component of the ERAD system and, via its ubiquitin-like domain, is thought to be involved in the destruction of misfolded proteins. Recombinant human HERPUD1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02435
Size 50 µg
Host E.coli
Accession
Molecular Weight 31.6 kDa (286aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEINRD
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 10% glycerol
Other Names Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERP, Mif1, SUP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap