Home / Products / proteins / Heme oxygenase1,1-266aa, Human, His-tagged, Recombinant, E.coli

Heme oxygenase1,1-266aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Heme oxygenase 1 belongs to the heme oxygenase family and is an essential enzyme in heme catabolism. It cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Also this protein is known to play an important role in the regulation of cardiovascular function and its adaptive response to a variety of stressors.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02432
Size 100 µg
Host E.coli
Accession
Molecular Weight 31.4 kDa (274 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MERPQPHSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 50 mM NaCl,0.1 mM PMSF, 10% glycerol
Other Names HO-1, Heat shock protein 32, HSP32
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap