HDDC2, 1-204aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
HDDC2 (HD domain-containing protein 2), also known as hepatitis C virus NS5A-transactivated protein 2, is an enzyme that contains one HD domain and belongs to the HDDC2 family. It is predicted to exhibit phosphohydrolase activity. This protein is suggested to participate in nucleic acid metabolism, signal transduction and possibly other functions in bacteria, archaea and eukaryotes. The HD domain consists of highly conserved residues, specifically histidines or aspartates. Porphyria cutanea tarda, Parkinson’s disease and Stickler syndrome have all been associated with this protein.Recombinant human HDDC2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02423
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.8 kDa(227aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. Phosphate Buffered Saline (pH7.4) containing 10% glycerol,
Other Names HD domain-containing protein 2, C6orf74, CGI-130, dJ167O5.2, NS5ATP2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap