H mgN1, 1-100aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
HMGN1, also known as non-histone chromosomal protein HMG-14, belongs to the HMGN family. Chromosomal protein HMGN1 binds to the inner side of the nucleosomal DNA, potentially altering the interaction between the DNA and the histone octamer. This protein may be involved in the process that maintains transcribable genes in a unique chromatin conformation. Recombinant human HMGN1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02386
Size 50 µg
Host E.coli
Accession
Molecular Weight 11.7 kDa (108aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSDLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT, 0.1mM PMSF
Other Names Non-histone chromosomal protein HMG-14, HMG14, GC104230
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap