Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP02386 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 11.7 kDa (108aa), confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSDLEHHHHHH |
Purity | > 95% by HPLC |
Concentration | 0.5 mg/ml (determined by Bradford assay) |
Formulation | Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT, 0.1mM PMSF |
Other Names | Non-histone chromosomal protein HMG-14, HMG14, GC104230 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap