GZMH, 19-246aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
GZMH, as known as granzyme H isoform 1, is a member of the granzyme family of serine proteases found specifically in the granules of cytotoxic Tlymphocytes (CTL) and natural killer (NK) cells. The more abundant expression of this protein than granzyme B in NK cells suggests that granzyme H may complement the pro-apoptotic function of granzyme B in this cell type. Recombinant human GZMH, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02382
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 26.2kDa (234aa); 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences EEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRLHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Granzyme H isoform 1, GZMH, CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap