Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP02371 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 10.4 kDa (94aa) confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSMVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK |
Purity | > 95% by HPLC |
Concentration | 1.0 mg/ml (determined by Bradford assay) |
Formulation | Liquid, In Phosphate buffered saline (pH7.4) containing 10% glycerol |
Other Names | General transcription factor IIH subunit 5, bA120J8.2, C6orf175, TFB5, TFIIH, TGF2H5, TTD, TTD-A, TTDA |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap