Home / Products / proteins / GSTZ1, 1-216aa, Human, His-tag, E.coli

GSTZ1, 1-216aa, Human, His-tag, E.coli

Categories: [Proteins / Peptides]
GSTZ1, also known as maleylacetoacetate isomerase, is an enzyme that belongs to glutathione Stransferase (GSTs) super-family. This enzyme acts by catalyzing the reaction of glutathione with an acceptor molecule to form an S-substituted glutathione (S=sulfur). The reactions utilizing glutathione contribute the transformation of a wide variety of electrophiles, including reactive products of lipid, protein, carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02366
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.2 kDa (236aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline pH7.4 containing 10% glycerol
Other Names Glutathione S-transferase zeta 1, GSTZ1-1, MAAI, MAI
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap