GSTT1, 1-240aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Glutathione S-transferase theta 1(GSTT1) is one of the GSTs’ four main classes: alpha, mu, pi, theta. This enzyme is involved in activation and detoxification reactions and catalyzes the conjugation of industrial chemicals, e.g. epoxybutane, ethylene oxides, halomethane with glutathione. The absence of the GSTTI enzyme, might determine the individual risk for development of acquired aplastic anemia and acute myeloid leukemia.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02364
Size 100 µg
Host E.coli
Accession
Molecular Weight 31.5 kDa (277aa)
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Glutathione S-transferase theta 1, GST class-theta-1, Glutathione transferase T1-1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap