GSTO1, 1-241aa, Human, E.coli

Categories: [Proteins / Peptides]
GSTO1, also known as p28 or GSTTLp28, is a protein that localizes to the cytoplasm and contains both an N-terminal and a C-terminal GST domain. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. This protein has dehydroascorbate reductase activity and may function in the glutathione-ascorbate cycle as part of antioxidant metabolism.
List Price: $731
  • Buy 5 for $694.45 each and save 5%
  • Buy 21 for $657.9 each and save 10%
  • Buy 31 for $621.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02360
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.5 kDa (241aa)
AP_Mol_Weight
Tag
Sequences MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT 10% glycerol
Other Names Glutathione S-transferase omega-1, GSTTLp28, P28
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap